SCOP 1.63: Domain d1h24c_: 1h24 C:

Lineage for d1h24c_ (1h24 C:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.1: Serine/threonin kinases [56113] (21 proteins)

6. Protein Cyclin-dependent PK (CDK, different isozymes) [56114] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56115] (47 PDB entries)

8. Domain d1h24c_: 1h24 C: [76519]
   Other proteins in same PDB: d1h24b1, d1h24b2, d1h24d1, d1h24d2
   complex with cyclin and a 9 residue recruitment peptide from E2F
   complexed with tpo

Details for d1h24c_

PDB Entry: 1h24, 2.5 Å

PDB Description: cdk2/cyclin a in complex with a 9 residue recruitment peptide from e2f

SCOP Domain Sequences for d1h24c_:

Sequence; same for both SEQRES and ATOM records:

>d1h24c_ d.144.1.1 (C:) Cyclin-dependent PK (CDK, different isozymes) {Human (Homo sapiens)}
smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpv

Timeline for d1h24c_:

• d1h24c_ is new in SCOP 1.63
  
• d1h24c_ appears in SCOP 1.65
  
• d1h24c_ appears in the current release, SCOPe 2.08, called d1h24c1