PDB entry 1h24

View 1h24 on RCSB PDB site
Description: cdk2/cyclin a in complex with a 9 residue recruitment peptide from e2f
Deposited on 2002-07-31, released 2003-02-01
The last revision prior to the SCOP 1.63 freeze date was dated 2003-02-01, with a file datestamp of 2003-02-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.212
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h24A (A:)
    smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
    hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
    shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
    ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
    fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h24B (B:)
    vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
    avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
    ehlvlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsv
    iagaafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyk
    nskyhgvsllnppetlnl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h24C (C:)
    smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
    hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
    shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
    ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
    fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h24D (D:)
    vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
    avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
    ehlvlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsv
    iagaafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyk
    nskyhgvsllnppetlnl