Lineage for d1h1va1 (1h1v A:5-146)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1171250Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1171251Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 1171252Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 1171253Protein Actin [53073] (6 species)
  7. 1171284Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (41 PDB entries)
    Uniprot P02568 ! SQ 02568
  8. 1171367Domain d1h1va1: 1h1v A:5-146 [76501]
    Other proteins in same PDB: d1h1vg1, d1h1vg2, d1h1vg3
    complexed with atp, ca

Details for d1h1va1

PDB Entry: 1h1v (more details), 3 Å

PDB Description: gelsolin g4-g6/actin complex
PDB Compounds: (A:) actin

SCOPe Domain Sequences for d1h1va1:

Sequence, based on SEQRES records: (download)

>d1h1va1 c.55.1.1 (A:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
ltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimf
etfnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records): (download)

>d1h1va1 c.55.1.1 (A:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprhmvgmgqkdsyvgdeaqskrgiltl
kypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetf
nvpamyvaiqavlslyasg

SCOPe Domain Coordinates for d1h1va1:

Click to download the PDB-style file with coordinates for d1h1va1.
(The format of our PDB-style files is described here.)

Timeline for d1h1va1: