![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.1: Actin/HSP70 [53068] (7 proteins) |
![]() | Protein Actin [53073] (6 species) |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (41 PDB entries) Uniprot P02568 ! SQ 02568 |
![]() | Domain d1h1va1: 1h1v A:5-146 [76501] Other proteins in same PDB: d1h1vg1, d1h1vg2, d1h1vg3 complexed with atp, ca |
PDB Entry: 1h1v (more details), 3 Å
SCOPe Domain Sequences for d1h1va1:
Sequence, based on SEQRES records: (download)
>d1h1va1 c.55.1.1 (A:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi ltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimf etfnvpamyvaiqavlslyasg
>d1h1va1 c.55.1.1 (A:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} ttalvcdngsglvkagfagddapravfpsivgrprhmvgmgqkdsyvgdeaqskrgiltl kypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetf nvpamyvaiqavlslyasg
Timeline for d1h1va1: