SCOPe 2.02: Domain d1h1vg2: 1h1v G:533-628

Lineage for d1h1vg2 (1h1v G:533-628)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families)

5. Family d.109.1.1: Gelsolin-like [55754] (4 proteins)

6. Protein Gelsolin [55759] (2 species)
   consists of six similar domains

7. Species Human (Homo sapiens) [TaxId:9606] [55761] (32 PDB entries)
   Uniprot P20065 55-179

8. Domain d1h1vg2: 1h1v G:533-628 [76504]
   Other proteins in same PDB: d1h1va1, d1h1va2
   domains 4, 5 and 6
   complexed with atp, ca

Details for d1h1vg2

PDB Entry: 1h1v, 3 Å

PDB Description: gelsolin g4-g6/actin complex

PDB Compounds: (G:) gelsolin

SCOPe Domain Sequences for d1h1vg2:

Sequence; same for both SEQRES and ATOM records:

>d1h1vg2 d.109.1.1 (G:533-628) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
pastrlfqvransagatravevlpkagalnsndafvlktpsaaylwvgtgaseaektgaq
ellrvlraqpvqvaegsepdgfwealggkaayrtsp

Timeline for d1h1vg2:

• d1h1vg2 first appeared in SCOP 1.63
  
• d1h1vg2 appears in SCOPe 2.01
  
• d1h1vg2 appears in SCOPe 2.03
  
• d1h1vg2 appears in the current release, SCOPe 2.08