SCOPe 2.08: Domain d1h1va1: 1h1v A:5-146

Lineage for d1h1va1 (1h1v A:5-146)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Actin [53073] (10 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (78 PDB entries)
   Uniprot P02568 ! SQ 02568

8. Domain d1h1va1: 1h1v A:5-146 [76501]
   Other proteins in same PDB: d1h1vg1, d1h1vg2, d1h1vg3
   complexed with atp, ca

Details for d1h1va1

PDB Entry: 1h1v, 2.99 Å

PDB Description: gelsolin g4-g6/actin complex

PDB Compounds: (A:) actin

SCOPe Domain Sequences for d1h1va1:

Sequence, based on SEQRES records:

>d1h1va1 c.55.1.1 (A:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
ltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimf
etfnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records):

>d1h1va1 c.55.1.1 (A:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprhmvgmgqkdsyvgdeaqskrgiltl
kypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetf
nvpamyvaiqavlslyasg

Timeline for d1h1va1:

• d1h1va1 first appeared in SCOP 1.63
  
• d1h1va1 appears in SCOPe 2.07