Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.5: Serine carboxypeptidase-like [53499] (4 proteins) automatically mapped to Pfam PF00450 |
Protein Hydroxynitrile lyase [82500] (1 species) a novel cyanogenic enzyme |
Species Sorghum (Sorghum bicolor) [TaxId:4558] [82501] (1 PDB entry) |
Domain d1gxs.2: 1gxs C:,D: [76376] complexed with bez, dka, nag |
PDB Entry: 1gxs (more details), 2.3 Å
SCOPe Domain Sequences for d1gxs.2:
Sequence; same for both SEQRES and ATOM records: (download)
>g1gxs.2 c.69.1.5 (C:,D:) Hydroxynitrile lyase {Sorghum (Sorghum bicolor) [TaxId: 4558]} qqeddrilglpgqpngvafgmyggyvtiddnngralyywfqeadtadpaaaplvlwlngg pgcssiglgamqelgafrvhtngeslllneyawnkaanilfaespagvgfsysntssdls mgddkmaqdtytflvkwferfphynyrefyiagesghfipqlsqvvyrnrnnspfinfqg llvssgltndhedmigmfeswwhhglisdetrdsglkvcpgtsfmhptpectevwnkala eqgninpytiytptcdrepspyqrrfwXlppydpcavfnsinylnlpevqtalhanvsgi veypwtvcsntifdqwgqaaddllpvyreliqaglrvwvysgdtdsvvpvsstrrslaal elpvktswypwymapterevggwsvqyegltyvtvrgaghlvpvhrpaqafllfkqflkg epmpae
Timeline for d1gxs.2:
View in 3D Domains from other chains: (mouse over for more information) d1gxs.1, d1gxs.1, d1gxs.1, d1gxs.1 |