Lineage for d9icfa3 (9icf A:92-148)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2716398Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2716399Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
    automatically mapped to Pfam PF10391
  6. 2716400Protein DNA polymerase beta [81579] (2 species)
  7. 2716401Species Human (Homo sapiens) [TaxId:9606] [81575] (145 PDB entries)
  8. 2716494Domain d9icfa3: 9icf A:92-148 [76095]
    Other proteins in same PDB: d9icfa1, d9icfa4
    protein/DNA complex; complexed with dtp, na, zn

Details for d9icfa3

PDB Entry: 9icf (more details), 3 Å

PDB Description: dna polymerase beta (e.c.2.7.7.7)/dna complex + 2'-deoxyadenosine-5'-triphosphate, soaked in the presence of datp and zncl2
PDB Compounds: (A:) protein (DNA polymerase beta (e.c.2.7.7.7))

SCOPe Domain Sequences for d9icfa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d9icfa3 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens) [TaxId: 9606]}
dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfek

SCOPe Domain Coordinates for d9icfa3:

Click to download the PDB-style file with coordinates for d9icfa3.
(The format of our PDB-style files is described here.)

Timeline for d9icfa3: