Lineage for d1kfva3 (1kfv A:227-271)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2586757Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2586758Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2587144Family g.39.1.8: C-terminal, Zn-finger domain of MutM-like DNA repair proteins [81627] (3 proteins)
  6. 2587145Protein DNA repair protein MutM (Fpg) [81622] (4 species)
  7. 2587175Species Lactococcus lactis [TaxId:1358] [81619] (7 PDB entries)
    Uniprot P42371
  8. 2587182Domain d1kfva3: 1kfv A:227-271 [75888]
    Other proteins in same PDB: d1kfva1, d1kfva2, d1kfvb1, d1kfvb2
    protein/DNA complex; complexed with gol, zn

Details for d1kfva3

PDB Entry: 1kfv (more details), 2.55 Å

PDB Description: Crystal Structure of Lactococcus lactis Formamido-pyrimidine DNA Glycosylase (alias Fpg or MutM) Non Covalently Bound to an AP Site Containing DNA.
PDB Compounds: (A:) Formamido-pyrimidine DNA glycosylase

SCOPe Domain Sequences for d1kfva3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfva3 g.39.1.8 (A:227-271) DNA repair protein MutM (Fpg) {Lactococcus lactis [TaxId: 1358]}
stgkmqnelqvygktgekcsrcgaeiqkikvagrgthfcpvcqqk

SCOPe Domain Coordinates for d1kfva3:

Click to download the PDB-style file with coordinates for d1kfva3.
(The format of our PDB-style files is described here.)

Timeline for d1kfva3: