PDB entry 1kfv

View 1kfv on RCSB PDB site
Description: Crystal Structure of Lactococcus lactis Formamido-pyrimidine DNA Glycosylase (alias Fpg or MutM) Non Covalently Bound to an AP Site Containing DNA.
Class: hydrolase/DNA
Keywords: DNA repair enzyme, Abasic site, DNA, N-glycosylase, AP lyase, HYDROLASE-DNA COMPLEX
Deposited on 2001-11-23, released 2002-06-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.251
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Formamido-pyrimidine DNA glycosylase
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: MUTM or FPG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42371 (0-270)
      • engineered (0)
      • modified residue (31)
      • modified residue (74)
      • modified residue (95)
      • modified residue (230)
    Domains in SCOPe 2.07: d1kfva1, d1kfva2, d1kfva3
  • Chain 'B':
    Compound: Formamido-pyrimidine DNA glycosylase
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: MUTM or FPG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42371 (0-270)
      • engineered (0)
      • modified residue (31)
      • modified residue (74)
      • modified residue (95)
      • modified residue (230)
    Domains in SCOPe 2.07: d1kfvb1, d1kfvb2, d1kfvb3
  • Chain 'D':
    Compound: 5'-d(*cp*tp*cp*tp*tp*tp*(pdi)p*tp*tp*tp*cp*tp*c)-3'
  • Chain 'E':
    Compound: 5'-d(*gp*ap*gp*ap*ap*ap*cp*ap*ap*ap*gp*ap*g)-3'
  • Chain 'G':
    Compound: 5'-d(*cp*tp*cp*tp*tp*tp*(pdi)p*tp*tp*tp*cp*tp*c)-3'
  • Chain 'H':
    Compound: 5'-d(*gp*ap*gp*ap*ap*ap*cp*ap*ap*ap*gp*ap*g)-3'
  • Heterogens: ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kfvA (A:)
    gelpevetvrrelekrivgqkiisieatyprmvltgfeqlkkeltgktiqgisrrgkyli
    feigddfrlishlrmegkyrlatldaprekhdhltmkfadgqliyadvrkfgtwelistd
    qvlpyflkkkigpeptyedfdeklfreklrkstkkikpylleqtlvaglgniyvdevlwl
    akihpeketnqliessihllhdsiieilqkaiklggssirtysalgstgkmqnelqvygk
    tgekcsrcgaeiqkikvagrgthfcpvcqqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kfvA (A:)
    gelpevetvrrelekrivgqkiisieatyprmvltgfeqlkkeltgktiqgisrrgkyli
    feigddfrlishlrmegkyrlatldaprekhdhltmkfadgqliyadvrkfgtwelistd
    qvlpyflkkkigpeptyedfdeklfreklrkstkkikpylleqtlvaglgniyvdevlwl
    akihpeketnqliessihllhdsiieilqkaiklggssistgkmqnelqvygktgekcsr
    cgaeiqkikvagrgthfcpvcqqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kfvB (B:)
    gelpevetvrrelekrivgqkiisieatyprmvltgfeqlkkeltgktiqgisrrgkyli
    feigddfrlishlrmegkyrlatldaprekhdhltmkfadgqliyadvrkfgtwelistd
    qvlpyflkkkigpeptyedfdeklfreklrkstkkikpylleqtlvaglgniyvdevlwl
    akihpeketnqliessihllhdsiieilqkaiklggssirtysalgstgkmqnelqvygk
    tgekcsrcgaeiqkikvagrgthfcpvcqqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kfvB (B:)
    gelpevetvrrelekrivgqkiisieatyprmvltgfeqlkkeltgktiqgisrrgkyli
    feigddfrlishlrmegkyrlatldaprekhdhltmkfadgqliyadvrkfgtwelistd
    qvlpyflkkkigpeptyedfdeklfreklrkstkkikpylleqtlvaglgniyvdevlwl
    akihpeketnqliessihllhdsiieilqkaiklggsgkmqnelqvygktgekcsrcgae
    iqkikvagrgthfcpvcqqk
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.