SCOPe 2.08: Domain d1kfvb2: 1kfv B:1-131

Lineage for d1kfvb2 (1kfv B:1-131)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
   pseudobarrel; capped on both ends by alpha-helices

4. Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (2 families)
   automatically mapped to Pfam PF01149

5. Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (4 proteins)

6. Protein DNA repair protein MutM (Fpg) [81621] (4 species)

7. Species Lactococcus lactis [TaxId:1358] [81617] (7 PDB entries)
   Uniprot P42371

8. Domain d1kfvb2: 1kfv B:1-131 [75890]
   Other proteins in same PDB: d1kfva1, d1kfva3, d1kfvb1, d1kfvb3
   protein/DNA complex; complexed with gol, zn

Details for d1kfvb2

PDB Entry: 1kfv, 2.55 Å

PDB Description: crystal structure of lactococcus lactis formamido-pyrimidine dna glycosylase (alias fpg or mutm) non covalently bound to an ap site containing dna.

PDB Compounds: (B:) Formamido-pyrimidine DNA glycosylase

SCOPe Domain Sequences for d1kfvb2:

Sequence; same for both SEQRES and ATOM records:

>d1kfvb2 b.113.1.1 (B:1-131) DNA repair protein MutM (Fpg) {Lactococcus lactis [TaxId: 1358]}
gelpevetvrrelekrivgqkiisieatyprmvltgfeqlkkeltgktiqgisrrgkyli
feigddfrlishlrmegkyrlatldaprekhdhltmkfadgqliyadvrkfgtwelistd
qvlpyflkkki

Timeline for d1kfvb2:

• d1kfvb2 first appeared in SCOP 1.63
  
• d1kfvb2 appears in SCOPe 2.07