Lineage for d1m8aa_ (1m8a A:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.9: IL8-like [54116] (2 superfamilies) Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) 
Family d.9.1.1: Interleukin 8-like chemokines [54118] (22 proteins) 
Protein Macrophage inflammatory protein, MIP [54128] (5 species) Species Human (Homo sapiens), ccl20/mip-3a [TaxId:9606] [75340] (1 PDB entry) 
Domain d1m8aa_: 1m8a A: [74579]
Details for d1m8aa_
PDB Entry: 1m8a (more details), 1.7 Å
PDB Description: Human MIP-3alpha/CCL20
SCOP Domain Sequences for d1m8aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m8aa_ d.9.1.1 (A:) Macrophage inflammatory protein, MIP {Human (Homo sapiens), ccl20/mip-3a}
dcclgytdrilhpkfivgftrqlanegcdinaiifhtkkklsvcanpkqtwvkyivrlls
k
SCOP Domain Coordinates for d1m8aa_:
Click to download the PDB-style file with coordinates for d1m8aa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1m8aa_:
- d1m8aa_ is new in SCOP 1.61
- d1m8aa_ appears in SCOP 1.63
- d1m8aa_ appears in the current release, SCOPe 2.08
View in 3D
