Lineage for d1m8ab_ (1m8a B:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 188772Fold d.9: IL8-like [54116] (2 superfamilies)
  4. 188773Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
  5. 188774Family d.9.1.1: Interleukin 8-like chemokines [54118] (22 proteins)
  6. 188834Protein Macrophage inflammatory protein, MIP [54128] (5 species)
  7. 188846Species Human (Homo sapiens), ccl20/mip-3a [TaxId:9606] [75340] (1 PDB entry)
  8. 188848Domain d1m8ab_: 1m8a B: [74580]

Details for d1m8ab_

PDB Entry: 1m8a (more details), 1.7 Å

PDB Description: Human MIP-3alpha/CCL20

SCOP Domain Sequences for d1m8ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m8ab_ d.9.1.1 (B:) Macrophage inflammatory protein, MIP {Human (Homo sapiens), ccl20/mip-3a}
dcclgytdrilhpkfivgftrqlanegcdinaiifhtkkklsvcanpkqtwvkyivrlls
k

SCOP Domain Coordinates for d1m8ab_:

Click to download the PDB-style file with coordinates for d1m8ab_.
(The format of our PDB-style files is described here.)

Timeline for d1m8ab_: