PDB entry 1m8a

View 1m8a on RCSB PDB site
Description: Human MIP-3alpha/CCL20
Deposited on 2002-07-24, released 2002-07-31
The last revision prior to the SCOP 1.61 freeze date was dated 2002-07-31, with a file datestamp of 2002-07-31.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.19
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1m8aa_
  • Chain 'B':
    Domains in SCOP 1.61: d1m8ab_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m8aA (A:)
    dcclgytdrilhpkfivgftrqlanegcdinaiifhtkkklsvcanpkqtwvkyivrlls
    k
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m8aB (B:)
    dcclgytdrilhpkfivgftrqlanegcdinaiifhtkkklsvcanpkqtwvkyivrlls
    k