SCOPe 2.08: Domain d1m1pc_: 1m1p C:

Lineage for d1m1pc_ (1m1p C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
   the main characteristic feature of this motif is the packing of its two hemes
   many members contains one or more complete motifs flanked by incomplete motifs and/or other domains

6. Protein Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain [48721] (3 species)

7. Species Shewanella oneidensis [TaxId:70863] [74808] (4 PDB entries)

8. Domain d1m1pc_: 1m1p C: [74415]
   complexed with hec, so4

Details for d1m1pc_

PDB Entry: 1m1p, 1.55 Å

PDB Description: p21 crystal structure of the tetraheme cytochrome c3 from shewanella oneidensis mr1

PDB Compounds: (C:) small tetraheme cytochrome c

SCOPe Domain Sequences for d1m1pc_:

Sequence, based on SEQRES records:

>d1m1pc_ a.138.1.3 (C:) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella oneidensis [TaxId: 70863]}
qklsdfhaesggceschkdgtpsadgafefaqcqschgklsemdavhkphdgnlvcadch
avhdmnvgqkptceschddgrtsasvl

Sequence, based on observed residues (ATOM records):

>d1m1pc_ a.138.1.3 (C:) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella oneidensis [TaxId: 70863]}
qklsdfhaesgceschkdgtpsadgafefaqcqschgklsemdavhkphdgnlvcadcha
vhdmnvgqkptceschddgrtsasvl

Timeline for d1m1pc_:

• d1m1pc_ first appeared in SCOP 1.61
  
• d1m1pc_ appears in SCOPe 2.07