SCOPe 2.07: Domain d1lqbb_: 1lqb B:

Lineage for d1lqbb_ (1lqb B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)

6. Protein Elongin C [54699] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54700] (54 PDB entries)

8. Domain d1lqbb_: 1lqb B: [74185]
   Other proteins in same PDB: d1lqba_, d1lqbc_
   complexed with so4

Details for d1lqbb_

PDB Entry: 1lqb, 2 Å

PDB Description: Crystal structure of a hydroxylated HIF-1 alpha peptide bound to the pVHL/elongin-C/elongin-B complex

PDB Compounds: (B:) elongin c

SCOPe Domain Sequences for d1lqbb_:

Sequence, based on SEQRES records:

>d1lqbb_ d.42.1.1 (B:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records):

>d1lqbb_ d.42.1.1 (B:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpnevnfreipshvlskvcmyftykvryt
nssteipefpiapeialellmaanfldc

Timeline for d1lqbb_:

• d1lqbb_ first appeared in SCOP 1.61
  
• d1lqbb_ appears in SCOPe 2.06
  
• d1lqbb_ appears in the current release, SCOPe 2.08