Lineage for d1lqbb_ (1lqb B:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191314Fold d.42: POZ domain [54694] (1 superfamily)
  4. 191315Superfamily d.42.1: POZ domain [54695] (2 families) (S)
  5. 191316Family d.42.1.1: BTB/POZ domain [54696] (2 proteins)
  6. 191317Protein Elongin C [54699] (2 species)
  7. 191320Species Human (Homo sapiens) [TaxId:9606] [54700] (3 PDB entries)
  8. 191322Domain d1lqbb_: 1lqb B: [74185]
    Other proteins in same PDB: d1lqba_, d1lqbc_

Details for d1lqbb_

PDB Entry: 1lqb (more details), 2 Å

PDB Description: Crystal structure of a hydroxylated HIF-1 alpha peptide bound to the pVHL/elongin-C/elongin-B complex

SCOP Domain Sequences for d1lqbb_:

Sequence, based on SEQRES records: (download)

>d1lqbb_ d.42.1.1 (B:) Elongin C {Human (Homo sapiens)}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records): (download)

>d1lqbb_ d.42.1.1 (B:) Elongin C {Human (Homo sapiens)}
myvklissdghefivkrehaltsgtikamlsgpnevnfreipshvlskvcmyftykvryt
nssteipefpiapeialellmaanfldc

SCOP Domain Coordinates for d1lqbb_:

Click to download the PDB-style file with coordinates for d1lqbb_.
(The format of our PDB-style files is described here.)

Timeline for d1lqbb_: