Lineage for d1lqba_ (1lqb A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2538336Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2538361Protein Elongin B [54246] (2 species)
  7. 2538362Species Human (Homo sapiens) [TaxId:9606] [54247] (51 PDB entries)
  8. 2538364Domain d1lqba_: 1lqb A: [74184]
    Other proteins in same PDB: d1lqbb_, d1lqbc_
    complexed with so4

Details for d1lqba_

PDB Entry: 1lqb (more details), 2 Å

PDB Description: Crystal structure of a hydroxylated HIF-1 alpha peptide bound to the pVHL/elongin-C/elongin-B complex
PDB Compounds: (A:) elongin b

SCOPe Domain Sequences for d1lqba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lqba_ d.15.1.1 (A:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvmk

SCOPe Domain Coordinates for d1lqba_:

Click to download the PDB-style file with coordinates for d1lqba_.
(The format of our PDB-style files is described here.)

Timeline for d1lqba_: