SCOP 1.63: Domain d1lkzb2: 1lkz B:127-198

Lineage for d1lkzb2 (1lkz B:127-198)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.40: D-ribose-5-phosphate isomerase (RpiA), lid domain [75445] (1 family)

5. Family d.58.40.1: D-ribose-5-phosphate isomerase (RpiA), lid domain [75446] (1 protein)

6. Protein D-ribose-5-phosphate isomerase (RpiA), lid domain [75447] (3 species)

7. Species Escherichia coli [TaxId:562] [75448] (3 PDB entries)

8. Domain d1lkzb2: 1lkz B:127-198 [73994]
   Other proteins in same PDB: d1lkza1, d1lkzb1
   complexed with mse

Details for d1lkzb2

PDB Entry: 1lkz, 2.5 Å

PDB Description: crystal structure of d-ribose-5-phosphate isomerase (rpia) from escherichia coli.

SCOP Domain Sequences for d1lkzb2:

Sequence; same for both SEQRES and ATOM records:

>d1lkzb2 d.58.40.1 (B:127-198) D-ribose-5-phosphate isomerase (RpiA), lid domain {Escherichia coli}
gkfplpvevipmarsavarqlvklggrpeyrqgvvtdngnvildvhgmeildpiamenai
naipgvvtvglf

Timeline for d1lkzb2:

• d1lkzb2 first appeared in SCOP 1.61
  
• d1lkzb2 appears in SCOP 1.65
  
• d1lkzb2 appears in the current release, SCOPe 2.08