![]() | Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (48 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.40: D-ribose-5-phosphate isomerase (RpiA), lid domain [75445] (1 family) ![]() |
![]() | Family d.58.40.1: D-ribose-5-phosphate isomerase (RpiA), lid domain [75446] (1 protein) |
![]() | Protein D-ribose-5-phosphate isomerase (RpiA), lid domain [75447] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [75448] (3 PDB entries) |
![]() | Domain d1lkzb2: 1lkz B:127-198 [73994] Other proteins in same PDB: d1lkza1, d1lkzb1 complexed with mse |
PDB Entry: 1lkz (more details), 2.5 Å
SCOP Domain Sequences for d1lkzb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lkzb2 d.58.40.1 (B:127-198) D-ribose-5-phosphate isomerase (RpiA), lid domain {Escherichia coli} gkfplpvevipmarsavarqlvklggrpeyrqgvvtdngnvildvhgmeildpiamenai naipgvvtvglf
Timeline for d1lkzb2: