![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (5 families) ![]() |
![]() | Family c.55.1.1: Actin/HSP70 [53068] (6 proteins) |
![]() | Protein Actin [53073] (5 species) |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (9 PDB entries) |
![]() | Domain d1lcub1: 1lcu B:1015-1157 [73832] |
PDB Entry: 1lcu (more details), 3.5 Å
SCOP Domain Sequences for d1lcub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lcub1 c.55.1.1 (B:1015-1157) Actin {Rabbit (Oryctolagus cuniculus)} ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvvmgqgdsyvgdeaqskrgi ltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimf etfnvpamyvaiqavlslyasgr
Timeline for d1lcub1: