SCOP 1.61: Domain d1lcua1: 1lcu A:15-157

Lineage for d1lcua1 (1lcu A:15-157)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (5 families)

5. Family c.55.1.1: Actin/HSP70 [53068] (6 proteins)

6. Protein Actin [53073] (5 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (9 PDB entries)

8. Domain d1lcua1: 1lcu A:15-157 [73830]

Details for d1lcua1

PDB Entry: 1lcu, 3.5 Å

PDB Description: polylysine induces an antiparallel actin dimer that nucleates filament assembly: crystal structure at 3.5 a resolution

SCOP Domain Sequences for d1lcua1:

Sequence, based on SEQRES records:

>d1lcua1 c.55.1.1 (A:15-157) Actin {Rabbit (Oryctolagus cuniculus)}
ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvvmgqgdsyvgdeaqskrgi
ltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimf
etfnvpamyvaiqavlslyasgr

Sequence, based on observed residues (ATOM records):

>d1lcua1 c.55.1.1 (A:15-157) Actin {Rabbit (Oryctolagus cuniculus)}
ttalvcdngsglvkagfagddapravfpsivgrprhdsyvgdeaqskrgiltlkypiehg
iitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamyv
aiqavlslyasgr

Timeline for d1lcua1:

• d1lcua1 is new in SCOP 1.61
  
• d1lcua1 appears in SCOP 1.63
  
• d1lcua1 appears in the current release, SCOPe 2.08