Lineage for d1lcub2 (1lcu B:1158-1385)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 181999Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 182000Superfamily c.55.1: Actin-like ATPase domain [53067] (5 families) (S)
  5. 182001Family c.55.1.1: Actin/HSP70 [53068] (6 proteins)
  6. 182002Protein Actin [53073] (5 species)
  7. 182016Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (9 PDB entries)
  8. 182032Domain d1lcub2: 1lcu B:1158-1385 [73833]

Details for d1lcub2

PDB Entry: 1lcu (more details), 3.5 Å

PDB Description: polylysine induces an antiparallel actin dimer that nucleates filament assembly: crystal structure at 3.5 a resolution

SCOP Domain Sequences for d1lcub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lcub2 c.55.1.1 (B:1158-1385) Actin {Rabbit (Oryctolagus cuniculus)}
ttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaere
ivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsfi
gmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmki
kiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrkcf

SCOP Domain Coordinates for d1lcub2:

Click to download the PDB-style file with coordinates for d1lcub2.
(The format of our PDB-style files is described here.)

Timeline for d1lcub2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lcub1