Lineage for d1l9jh1 (1l9j H:36-253)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791427Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 2791428Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 2791429Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)
  6. 2791430Protein Photosynthetic reaction centre [50348] (4 species)
  7. 2791431Species Rhodobacter sphaeroides [TaxId:1063] [50350] (88 PDB entries)
    Uniprot P11846
  8. 2791506Domain d1l9jh1: 1l9j H:36-253 [73724]
    Other proteins in same PDB: d1l9jc_, d1l9jd_, d1l9jh2, d1l9jl_, d1l9jm_, d1l9jr_, d1l9js_, d1l9jt2
    complexed with bcl, bph, cl, fe2, hem, lda, u10

Details for d1l9jh1

PDB Entry: 1l9j (more details), 3.25 Å

PDB Description: X-Ray Structure of the Cytochrome-c(2)-Photosynthetic Reaction Center Electron Transfer Complex from Rhodobacter sphaeroides in Type I Co-Crystals
PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d1l9jh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l9jh1 b.41.1.1 (H:36-253) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksvva

SCOPe Domain Coordinates for d1l9jh1:

Click to download the PDB-style file with coordinates for d1l9jh1.
(The format of our PDB-style files is described here.)

Timeline for d1l9jh1: