| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
| Family a.3.1.1: monodomain cytochrome c [46627] (16 protein domains) |
| Protein Cytochrome c2 [46650] (8 species) |
| Species Rhodobacter sphaeroides [TaxId:1063] [46653] (5 PDB entries) |
| Domain d1l9jd_: 1l9j D: [73723] Other proteins in same PDB: d1l9jh1, d1l9jh2, d1l9jl_, d1l9jm_, d1l9jr_, d1l9js_, d1l9jt1, d1l9jt2 complexed with bcl, bph, cl, fe2, hem, lda, u10 |
| PDB Entry: 1l9j (more details) PDB Description: x-ray structure of the cytochrome-c(2)-photosynthetic reacti electron transfer complex from rhodobacter sphaeroides in t crystals
PDB Compounds: (D:) cytochrome c-2SCOP Domain Sequences for d1l9jd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l9jd_ a.3.1.1 (D:) Cytochrome c2 {Rhodobacter sphaeroides [TaxId: 1063]}
qegdpeagakafnqcqtchvivddsgttiagrnaktgpnlygvvgrtagtqadfkgygeg
mkeagakglawdeehfvqyvqdptkflkeytgdakakgkmtfklkkeadahniwaylqqv
avrp
SCOP Domain Coordinates for d1l9jd_:
Click to download the PDB-style file with coordinates for d1l9jd_. (The format of our PDB-style files is described here.)
Timeline for d1l9jd_:
d1l9jd_ appears in SCOP 1.75A | d1l9jd_ (click for larger image) d1l9jd_ in context of chain d1l9jd_ in context of PDB Domains from other chains: d1l9jc_, d1l9jh1, d1l9jh2, d1l9jl_, d1l9jm_, d1l9jr_, d1l9js_, d1l9jt1, d1l9jt2 |
|
|
Copyright © 1994-2013 The SCOP
and Astral authors scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu |