| Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
| Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() |
| Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 protein domains) L and M are probably related to each other |
| Protein L (light) subunit [81477] (3 species) |
| Species Rhodobacter sphaeroides [TaxId:1063] [81475] (49 PDB entries) Uniprot P02954 |
| Domain d1l9jr_: 1l9j R: [73728] Other proteins in same PDB: d1l9jc_, d1l9jd_, d1l9jh1, d1l9jh2, d1l9jm_, d1l9js_, d1l9jt1, d1l9jt2 complexed with bcl, bph, cl, fe2, hem, lda, u10 |
| PDB Entry: 1l9j (more details) PDB Description: x-ray structure of the cytochrome-c(2)-photosynthetic reacti electron transfer complex from rhodobacter sphaeroides in t crystals
PDB Compounds: (R:) reaction center protein l chainSCOP Domain Sequences for d1l9jr_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l9jr_ f.26.1.1 (R:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
SCOP Domain Coordinates for d1l9jr_:
Click to download the PDB-style file with coordinates for d1l9jr_. (The format of our PDB-style files is described here.)
Timeline for d1l9jr_:
d1l9jr_ appears in SCOP 1.75A | d1l9jr_ (click for larger image) d1l9jr_ in context of chain d1l9jr_ in context of PDB Domains from other chains: d1l9jc_, d1l9jd_, d1l9jh1, d1l9jh2, d1l9jl_, d1l9jm_, d1l9js_, d1l9jt1, d1l9jt2 |
|
|
Copyright © 1994-2013 The SCOP
and Astral authors scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu |