PDB entry 1l9j

View 1l9j on RCSB PDB site
Description: X-Ray Structure of the Cytochrome-c(2)-Photosynthetic Reaction Center Electron Transfer Complex from Rhodobacter sphaeroides in Type I Co-Crystals
Class: photosynthesis
Keywords: bacterial photosynthesis, electron transfer proteins, protein-protein interactions, membrane proteins, protein complexes, PHOTOSYNTHESIS
Deposited on 2002-03-24, released 2002-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3.25 Å
R-factor: 0.248
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: cytochrome c-2
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l9jc_
  • Chain 'D':
    Compound: cytochrome c-2
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l9jd_
  • Chain 'H':
    Compound: reaction center protein h chain
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l9jh1, d1l9jh2
  • Chain 'L':
    Compound: reaction center protein l chain
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l9jl_
  • Chain 'M':
    Compound: reaction center protein m chain
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l9jm_
  • Chain 'R':
    Compound: reaction center protein l chain
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l9jr_
  • Chain 'S':
    Compound: reaction center protein m chain
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l9js_
  • Chain 'T':
    Compound: reaction center protein h chain
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l9jt1, d1l9jt2
  • Heterogens: FE2, CL, BCL, BPH, U10, HEM, LDA, HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l9jC (C:)
    qegdpeagakafnqcqtchvivddsgttiagrnaktgpnlygvvgrtagtqadfkgygeg
    mkeagakglawdeehfvqyvqdptkflkeytgdakakgkmtfklkkeadahniwaylqqv
    avrp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l9jD (D:)
    qegdpeagakafnqcqtchvivddsgttiagrnaktgpnlygvvgrtagtqadfkgygeg
    mkeagakglawdeehfvqyvqdptkflkeytgdakakgkmtfklkkeadahniwaylqqv
    avrp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1l9jH (H:)
    mvgvtafgnfdlaslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpk
    pktfilphgrgtltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdl
    peldghghnkikpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarfle
    velkdgstrllpmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagg
    lmyaapkrksvvaamlaeya
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l9jH (H:)
    gnfdlaslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpkpktfilp
    hgrgtltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdlpeldghg
    hnkikpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarflevelkdgs
    trllpmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagglmyaapk
    rksvva
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l9jL (L:)
    allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
    pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
    fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
    ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
    vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1l9jM (M:)
    aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
    fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
    fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
    shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
    rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
    hgmapln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l9jM (M:)
    fstllgwfgnaqlgpiylgslgvlslfsglmwfftigiwfwyqagwnpavflrdlfffsl
    eppapeyglsfaaplkegglwliasffmfvavwswwgrtylraqalgmgkhtawaflsai
    wlwmvlgfirpilmgswseavpygifshldwtnnfslvhgnlfynpfhglsiaflygsal
    lfamhgatilavsrfggereleqiadrgtaaeraalfwrwtmgfnatmegihrwaiwmav
    lvtltggigillsgtvvdnwyvwgqnh
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l9jR (R:)
    allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
    pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
    fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
    ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
    vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1l9jS (S:)
    aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
    fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
    fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
    shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
    rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
    hgmapln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l9jS (S:)
    fstllgwfgnaqlgpiylgslgvlslfsglmwfftigiwfwyqagwnpavflrdlfffsl
    eppapeyglsfaaplkegglwliasffmfvavwswwgrtylraqalgmgkhtawaflsai
    wlwmvlgfirpilmgswseavpygifshldwtnnfslvhgnlfynpfhglsiaflygsal
    lfamhgatilavsrfggereleqiadrgtaaeraalfwrwtmgfnatmegihrwaiwmav
    lvtltggigillsgtvvdnwyvwgqnh
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1l9jT (T:)
    mvgvtafgnfdlaslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpk
    pktfilphgrgtltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdl
    peldghghnkikpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarfle
    velkdgstrllpmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagg
    lmyaapkrksvvaamlaeya
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l9jT (T:)
    gnfdlaslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpkpktfilp
    hgrgtltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdlpeldghg
    hnkikpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarflevelkdgs
    trllpmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagglmyaapk
    rksvva