Lineage for d1l5ha_ (1l5h A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143226Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2143333Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2143391Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (3 protein domains)
    contains three domains of this fold; "Helical backbone" holds domains 2 and 3
    both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
    automatically mapped to Pfam PF00148
  6. 2143392Protein Nitrogenase iron-molybdenum protein, alpha chain [81402] (3 species)
  7. 2143393Species Azotobacter vinelandii [TaxId:354] [81398] (14 PDB entries)
  8. 2143414Domain d1l5ha_: 1l5h A: [73590]
    Other proteins in same PDB: d1l5hb_
    FeMo-cofactor deficient
    complexed with ca, clf

Details for d1l5ha_

PDB Entry: 1l5h (more details), 2.3 Å

PDB Description: FeMo-cofactor Deficient Nitrogenase MoFe Protein
PDB Compounds: (A:) nitrogenase molybdenum-iron protein alpha chain

SCOPe Domain Sequences for d1l5ha_:

Sequence, based on SEQRES records: (download)

>d1l5ha_ c.92.2.3 (A:) Nitrogenase iron-molybdenum protein, alpha chain {Azotobacter vinelandii [TaxId: 354]}
nkksqpglmtirgcayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvna
fvtmnftsdfqekdivfggdkklaklidevetlfplnkgisvqsecpigligddiesvsk
vkgaelsktivpvrcegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigd
yniggdawssrilleemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmee
kygipwmeynffgptktieslraiaakfdesiqkkceeviakykpeweavvakyrprleg
krvmlyigglrprhvigayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgye
feefvkrikpdligsgikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtln
npcwkklqapwe

Sequence, based on observed residues (ATOM records): (download)

>d1l5ha_ c.92.2.3 (A:) Nitrogenase iron-molybdenum protein, alpha chain {Azotobacter vinelandii [TaxId: 354]}
nkksqpglmtirgcayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvna
fvtmnftsdfqekdivfggdkklaklidevetlfplnkgisvqsecpigligddiesvsk
vkgaelsktivpvrcegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigd
yniggdawssrilleemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmee
kygipwmeynffgptktieslraiaakfdesiqkkceeviakykpeweavvakyrprleg
krvmlyigglrprhvigayedlgmevvgtgyeefeefvkrikpdligsgikekfifqkmg
ipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe

SCOPe Domain Coordinates for d1l5ha_:

Click to download the PDB-style file with coordinates for d1l5ha_.
(The format of our PDB-style files is described here.)

Timeline for d1l5ha_: