PDB entry 1l5h

View 1l5h on RCSB PDB site
Description: FeMo-cofactor Deficient Nitrogenase MoFe Protein
Class: oxidoreductase
Keywords: apo-protein, OXIDOREDUCTASE
Deposited on 2002-03-06, released 2002-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.249
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrogenase molybdenum-iron protein alpha chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l5ha_
  • Chain 'B':
    Compound: nitrogenase molybdenum-iron protein beta chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l5hb_
  • Heterogens: CA, CLF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l5hA (A:)
    tgmsreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirg
    cayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqek
    divfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpv
    rcegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssril
    leemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffg
    ptktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrpr
    hvigayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdli
    gsgikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwea
    segaekvaasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l5hA (A:)
    nkksqpglmtirgcayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvna
    fvtmnftsdfqekdivfggdkklaklidevetlfplnkgisvqsecpigligddiesvsk
    vkgaelsktivpvrcegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigd
    yniggdawssrilleemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmee
    kygipwmeynffgptktieslraiaakfdesiqkkceeviakykpeweavvakyrprleg
    krvmlyigglrprhvigayedlgmevvgtgyeefeefvkrikpdligsgikekfifqkmg
    ipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l5hB (B:)
    sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
    ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
    aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
    pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
    rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
    kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
    lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
    yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
    sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr