Lineage for d1l5ha_ (1l5h A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 186038Fold c.92: Chelatase-like [53799] (2 superfamilies)
  4. 186054Superfamily c.92.2: "Helical backbone" metal receptor [53807] (3 families) (S)
  5. 186071Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (1 protein)
  6. 186072Protein Nitrogenase iron-molybdenum protein, alpha and beta chains [53817] (3 species)
  7. 186073Species Azotobacter vinelandii [TaxId:354] [53819] (6 PDB entries)
  8. 186086Domain d1l5ha_: 1l5h A: [73590]

Details for d1l5ha_

PDB Entry: 1l5h (more details), 2.3 Å

PDB Description: FeMo-cofactor Deficient Nitrogenase MoFe Protein

SCOP Domain Sequences for d1l5ha_:

Sequence, based on SEQRES records: (download)

>d1l5ha_ c.92.2.3 (A:) Nitrogenase iron-molybdenum protein, alpha and beta chains {Azotobacter vinelandii}
nkksqpglmtirgcayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvna
fvtmnftsdfqekdivfggdkklaklidevetlfplnkgisvqsecpigligddiesvsk
vkgaelsktivpvrcegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigd
yniggdawssrilleemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmee
kygipwmeynffgptktieslraiaakfdesiqkkceeviakykpeweavvakyrprleg
krvmlyigglrprhvigayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgye
feefvkrikpdligsgikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtln
npcwkklqapwe

Sequence, based on observed residues (ATOM records): (download)

>d1l5ha_ c.92.2.3 (A:) Nitrogenase iron-molybdenum protein, alpha and beta chains {Azotobacter vinelandii}
nkksqpglmtirgcayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvna
fvtmnftsdfqekdivfggdkklaklidevetlfplnkgisvqsecpigligddiesvsk
vkgaelsktivpvrcegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigd
yniggdawssrilleemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmee
kygipwmeynffgptktieslraiaakfdesiqkkceeviakykpeweavvakyrprleg
krvmlyigglrprhvigayedlgmevvgtgyeefeefvkrikpdligsgikekfifqkmg
ipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe

SCOP Domain Coordinates for d1l5ha_:

Click to download the PDB-style file with coordinates for d1l5ha_.
(The format of our PDB-style files is described here.)

Timeline for d1l5ha_: