SCOP 1.61: Domain d1l3ea_: 1l3e A:

Lineage for d1l3ea_ (1l3e A:)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (10 superfamilies)

4. Superfamily a.137.10: C-terminal activation domain (CTAD) of HIF-1alpha [74800] (1 family)

5. Family a.137.10.1: C-terminal activation domain (CTAD) of HIF-1alpha [74801] (1 protein)

6. Protein C-terminal activation domain (CTAD) of HIF-1alpha [74802] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74803] (2 PDB entries)

8. Domain d1l3ea_: 1l3e A: [73535]
   Other proteins in same PDB: d1l3eb_

Details for d1l3ea_

PDB Entry: 1l3e

PDB Description: nmr structures of the hif-1alpha ctad/p300 ch1 complex

SCOP Domain Sequences for d1l3ea_:

Sequence; same for both SEQRES and ATOM records:

>d1l3ea_ a.137.10.1 (A:) C-terminal activation domain (CTAD) of HIF-1alpha {Human (Homo sapiens)}
gsmdesglpqltsydcevnapiqgsrnllqgeellraldqvn

Timeline for d1l3ea_:

• d1l3ea_ is new in SCOP 1.61
  
• d1l3ea_ appears in SCOP 1.63
  
• d1l3ea_ appears in the current release, SCOPe 2.08, called d1l3ea1