Lineage for d1l3ea1 (1l3e A:2-42)

  1. Root: SCOPe 2.08
  2. 3045664Class j: Peptides [58231] (151 folds)
  3. 3047306Fold j.96: Transactivation domain [81275] (1 superfamily)
  4. 3047307Superfamily j.96.1: Transactivation domain [74800] (1 family) (S)
  5. 3047308Family j.96.1.1: Transactivation domain [74801] (2 proteins)
  6. 3047309Protein C-terminal activation domain (CTAD) of HIF-1alpha [74802] (1 species)
  7. 3047310Species Human (Homo sapiens) [TaxId:9606] [74803] (4 PDB entries)
  8. 3047314Domain d1l3ea1: 1l3e A:2-42 [73535]
    Other proteins in same PDB: d1l3ea2, d1l3eb_
    complexed with TAZ1 domain of human CBP
    complexed with zn

Details for d1l3ea1

PDB Entry: 1l3e (more details)

PDB Description: nmr structures of the hif-1alpha ctad/p300 ch1 complex
PDB Compounds: (A:) hypoxia inducible factor-1 alpha subunit

SCOPe Domain Sequences for d1l3ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l3ea1 j.96.1.1 (A:2-42) C-terminal activation domain (CTAD) of HIF-1alpha {Human (Homo sapiens) [TaxId: 9606]}
smdesglpqltsydcevnapiqgsrnllqgeellraldqvn

SCOPe Domain Coordinates for d1l3ea1:

Click to download the PDB-style file with coordinates for d1l3ea1.
(The format of our PDB-style files is described here.)

Timeline for d1l3ea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1l3ea2
View in 3D
Domains from other chains:
(mouse over for more information)
d1l3eb_