SCOPe 2.07: Domain d1l1oc_: 1l1o C:

Lineage for d1l1oc_ (1l1o C:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
   barrel, closed; n=5, S=10

6. Protein Replication protein A 70 KDa subunit (RPA70) [50267] (1 species)
   duplication: consists of three domains of this fold; contains zinc-finger insert in the C-terminal domain, residues 479-511

7. Species Human (Homo sapiens) [TaxId:9606] [50268] (4 PDB entries)

8. Domain d1l1oc_: 1l1o C: [73480]
   Other proteins in same PDB: d1l1oa_, d1l1ob_, d1l1od_, d1l1oe_
   C-terminal domain only
   complexed with zn

Details for d1l1oc_

PDB Entry: 1l1o, 2.8 Å

PDB Description: Structure of the human Replication Protein A (RPA) trimerization core

PDB Compounds: (C:) Replication protein A 70 kDa DNA-binding subunit

SCOPe Domain Sequences for d1l1oc_:

Sequence, based on SEQRES records:

>d1l1oc_ b.40.4.3 (C:) Replication protein A 70 KDa subunit (RPA70) {Human (Homo sapiens) [TaxId: 9606]}
ntnwktlyevksenlgqgdkpdyfssvatvvylrkencmyqacptqdcnkkvidqqngly
rcekcdtefpnfkyrmilsvniadfqenqwvtcfqesaeailgqnaaylgelkdkneqaf
eevfqnanfrsfifrvrvkvetyndesrikatvmdvkpvdyreygrrlvmsirrsalm

Sequence, based on observed residues (ATOM records):

>d1l1oc_ b.40.4.3 (C:) Replication protein A 70 KDa subunit (RPA70) {Human (Homo sapiens) [TaxId: 9606]}
ntnwktlyevksenlgqgdkpdyfssvatvvylrkencmyqacptqdcnkkvidqqngly
rcekcdtefpnfkyrmilsvniadfqenqwvtcfqesaeailgqnaaylgelkdkneqaf
eevfqnanfrsfifrvrvkvetyikatvmdvkpvdyreygrrlvmsirrsalm

Timeline for d1l1oc_:

• d1l1oc_ first appeared in SCOP 1.61
  
• d1l1oc_ appears in SCOPe 2.06
  
• d1l1oc_ appears in the current release, SCOPe 2.08