Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins) barrel, closed; n=5, S=10 |
Domain d1l1oa_: 1l1o A: [73478] Other proteins in same PDB: d1l1ob_, d1l1oc_, d1l1oe_, d1l1of_ complexed with zn |
PDB Entry: 1l1o (more details), 2.8 Å
SCOPe Domain Sequences for d1l1oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l1oa_ b.40.4.3 (A:) Replication protein A 14 KDa (RPA14) subunit {Human (Homo sapiens) [TaxId: 9606]} dmmdlprsrinagmlaqfidkpvcfvgrlekihptgkmfilsdgegkngtielmepldee isgivevvgrvtakatilctsyvqfkedshpfdlglyneavkiihdfpqfyplgi
Timeline for d1l1oa_: