Lineage for d1kzyc1 (1kzy C:1714-1866)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1157252Fold c.15: BRCT domain [52112] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 1157253Superfamily c.15.1: BRCT domain [52113] (5 families) (S)
    Pfam PF00533
  5. 1157329Family c.15.1.4: 53BP1 [75148] (1 protein)
  6. 1157330Protein 53BP1 [75149] (1 species)
  7. 1157331Species Human (Homo sapiens) [TaxId:9606] [75150] (2 PDB entries)
  8. 1157332Domain d1kzyc1: 1kzy C:1714-1866 [73383]
    Other proteins in same PDB: d1kzya_, d1kzyb_
    protein/DNA complex; complexed with zn

Details for d1kzyc1

PDB Entry: 1kzy (more details), 2.5 Å

PDB Description: Crystal Structure of the 53bp1 BRCT Region Complexed to Tumor Suppressor P53
PDB Compounds: (C:) tumor suppressor p53-binding protein 1

SCOPe Domain Sequences for d1kzyc1:

Sequence, based on SEQRES records: (download)

>d1kzyc1 c.15.1.4 (C:1714-1866) 53BP1 {Human (Homo sapiens) [TaxId: 9606]}
aleeqrgplplnktlflgyaflltmattsdklasrsklpdgptgsseeeeefleippfnk
qytesqlragagyiledfneaqcntayqclliadqhcrtrkyflclasgipcvshvwvhd
schanqlqnyrnyllpagysleeqrildwqpre

Sequence, based on observed residues (ATOM records): (download)

>d1kzyc1 c.15.1.4 (C:1714-1866) 53BP1 {Human (Homo sapiens) [TaxId: 9606]}
aleeqrgplplnktlflgyaflltmatippfnkqytesqlragagyiledfneaqcntay
qclliadqhcrtrkyflclasgipcvshvwvhdschanqlqnyrnyllpagysleeqril
dwqpre

SCOPe Domain Coordinates for d1kzyc1:

Click to download the PDB-style file with coordinates for d1kzyc1.
(The format of our PDB-style files is described here.)

Timeline for d1kzyc1: