Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.15: BRCT domain [52112] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.15.1: BRCT domain [52113] (5 families) Pfam PF00533 |
Family c.15.1.4: 53BP1 [75148] (1 protein) |
Protein 53BP1 [75149] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [75150] (2 PDB entries) |
Domain d1kzyc1: 1kzy C:1714-1866 [73383] Other proteins in same PDB: d1kzya_, d1kzyb_ protein/DNA complex; complexed with zn |
PDB Entry: 1kzy (more details), 2.5 Å
SCOPe Domain Sequences for d1kzyc1:
Sequence, based on SEQRES records: (download)
>d1kzyc1 c.15.1.4 (C:1714-1866) 53BP1 {Human (Homo sapiens) [TaxId: 9606]} aleeqrgplplnktlflgyaflltmattsdklasrsklpdgptgsseeeeefleippfnk qytesqlragagyiledfneaqcntayqclliadqhcrtrkyflclasgipcvshvwvhd schanqlqnyrnyllpagysleeqrildwqpre
>d1kzyc1 c.15.1.4 (C:1714-1866) 53BP1 {Human (Homo sapiens) [TaxId: 9606]} aleeqrgplplnktlflgyaflltmatippfnkqytesqlragagyiledfneaqcntay qclliadqhcrtrkyflclasgipcvshvwvhdschanqlqnyrnyllpagysleeqril dwqpre
Timeline for d1kzyc1:
View in 3D Domains from other chains: (mouse over for more information) d1kzya_, d1kzyb_, d1kzyd1, d1kzyd2 |