SCOP 1.61: Domain d1kzyc1: 1kzy C:1714-1866

Lineage for d1kzyc1 (1kzy C:1714-1866)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.15: BRCT domain [52112] (1 superfamily)

4. Superfamily c.15.1: BRCT domain [52113] (4 families)

5. Family c.15.1.4: 53BP1 [75148] (1 protein)

6. Protein 53BP1 [75149] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75150] (2 PDB entries)

8. Domain d1kzyc1: 1kzy C:1714-1866 [73383]
   Other proteins in same PDB: d1kzya_, d1kzyb_

Details for d1kzyc1

PDB Entry: 1kzy, 2.5 Å

PDB Description: Crystal Structure of the 53bp1 BRCT Region Complexed to Tumor Suppressor P53

SCOP Domain Sequences for d1kzyc1:

Sequence, based on SEQRES records:

>d1kzyc1 c.15.1.4 (C:1714-1866) 53BP1 {Human (Homo sapiens)}
aleeqrgplplnktlflgyaflltmattsdklasrsklpdgptgsseeeeefleippfnk
qytesqlragagyiledfneaqcntayqclliadqhcrtrkyflclasgipcvshvwvhd
schanqlqnyrnyllpagysleeqrildwqpre

Sequence, based on observed residues (ATOM records):

>d1kzyc1 c.15.1.4 (C:1714-1866) 53BP1 {Human (Homo sapiens)}
aleeqrgplplnktlflgyaflltmatippfnkqytesqlragagyiledfneaqcntay
qclliadqhcrtrkyflclasgipcvshvwvhdschanqlqnyrnyllpagysleeqril
dwqpre

Timeline for d1kzyc1:

• d1kzyc1 is new in SCOP 1.61
  
• d1kzyc1 appears in SCOP 1.63
  
• d1kzyc1 appears in the current release, SCOPe 2.08