Class a: All alpha proteins [46456] (284 folds) |
Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
Superfamily a.126.1: Serum albumin-like [48552] (1 family) |
Family a.126.1.1: Serum albumin-like [48553] (2 proteins) |
Protein Vitamin D binding protein [69111] (1 species) domain 3 lacks the last subdomain |
Species Human (Homo sapiens) [TaxId:9606] [69112] (6 PDB entries) |
Domain d1kxpd2: 1kxp D:215-404 [73161] Other proteins in same PDB: d1kxpa1, d1kxpa2 complexed with skeletal actin complexed with atp, mg |
PDB Entry: 1kxp (more details), 2.1 Å
SCOPe Domain Sequences for d1kxpd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kxpd2 a.126.1.1 (D:215-404) Vitamin D binding protein {Human (Homo sapiens) [TaxId: 9606]} lsnrvcsqyaaygekksrlsnliklaqkvptadledvlplaeditnilskccesasedcm akelpehtvklcdnlstknskfedccqektamdvfvctyfmpaaqlpelpdvelptnkdv cdpgntkvmdkytfelsrrthlpevflskvleptlkslgeccdvedsttcfnakgpllkk elssfidkgq
Timeline for d1kxpd2: