SCOPe 2.03: Domain d1kxpd2: 1kxp D:215-404

Lineage for d1kxpd2 (1kxp D:215-404)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (1 family)

5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)

6. Protein Vitamin D binding protein [69111] (1 species)
   domain 3 lacks the last subdomain

7. Species Human (Homo sapiens) [TaxId:9606] [69112] (6 PDB entries)

8. Domain d1kxpd2: 1kxp D:215-404 [73161]
   Other proteins in same PDB: d1kxpa1, d1kxpa2
   complexed with skeletal actin
   complexed with atp, mg

Details for d1kxpd2

PDB Entry: 1kxp, 2.1 Å

PDB Description: crystal structure of human vitamin d-binding protein in complex with skeletal actin

PDB Compounds: (D:) human vitamin d-binding protein

SCOPe Domain Sequences for d1kxpd2:

Sequence; same for both SEQRES and ATOM records:

>d1kxpd2 a.126.1.1 (D:215-404) Vitamin D binding protein {Human (Homo sapiens) [TaxId: 9606]}
lsnrvcsqyaaygekksrlsnliklaqkvptadledvlplaeditnilskccesasedcm
akelpehtvklcdnlstknskfedccqektamdvfvctyfmpaaqlpelpdvelptnkdv
cdpgntkvmdkytfelsrrthlpevflskvleptlkslgeccdvedsttcfnakgpllkk
elssfidkgq

Timeline for d1kxpd2:

• d1kxpd2 first appeared in SCOP 1.61
  
• d1kxpd2 appears in SCOPe 2.02
  
• d1kxpd2 appears in SCOPe 2.04
  
• d1kxpd2 appears in the current release, SCOPe 2.08