SCOP 1.61: Domain d1kxpd2: 1kxp D:215-404

Lineage for d1kxpd2 (1kxp D:215-404)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)

4. Superfamily a.126.1: Serum albumin-like [48552] (1 family)

5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)

6. Protein Vitamin D binding protein [69111] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69112] (5 PDB entries)

8. Domain d1kxpd2: 1kxp D:215-404 [73161]
   Other proteins in same PDB: d1kxpa1, d1kxpa2

Details for d1kxpd2

PDB Entry: 1kxp, 2.1 Å

PDB Description: crystal structure of human vitamin d-binding protein in complex with skeletal actin

SCOP Domain Sequences for d1kxpd2:

Sequence; same for both SEQRES and ATOM records:

>d1kxpd2 a.126.1.1 (D:215-404) Vitamin D binding protein {Human (Homo sapiens)}
lsnrvcsqyaaygekksrlsnliklaqkvptadledvlplaeditnilskccesasedcm
akelpehtvklcdnlstknskfedccqektamdvfvctyfmpaaqlpelpdvelptnkdv
cdpgntkvmdkytfelsrrthlpevflskvleptlkslgeccdvedsttcfnakgpllkk
elssfidkgq

Timeline for d1kxpd2:

• d1kxpd2 is new in SCOP 1.61
  
• d1kxpd2 appears in SCOP 1.63
  
• d1kxpd2 appears in the current release, SCOPe 2.08