Lineage for d1kuya_ (1kuy A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209196Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2209197Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2209198Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2209524Protein Serotonin N-acetyltranferase [55746] (1 species)
  7. 2209525Species Sheep (Ovis aries) [TaxId:9940] [55747] (7 PDB entries)
  8. 2209530Domain d1kuya_: 1kuy A: [73022]
    complexed with cot

Details for d1kuya_

PDB Entry: 1kuy (more details), 2.4 Å

PDB Description: x-ray crystallographic studies of serotonin n-acetyltransferase catalysis and inhibition
PDB Compounds: (A:) serotonin n-acetyltransferase

SCOPe Domain Sequences for d1kuya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kuya_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]}
htlpanefrcltpedaagvfeiereafisvsgncplnldevqhfltlcpelslgwfvegr
lvafiigslwdeerltqeslalhrprghsahlhalavhrsfrqqgkgsvllwrylhhvga
qpavrravlmcedalvpfyqrfgfhpagpcaivvgsltftemhcsl

SCOPe Domain Coordinates for d1kuya_:

Click to download the PDB-style file with coordinates for d1kuya_.
(The format of our PDB-style files is described here.)

Timeline for d1kuya_: