PDB entry 1kuy

View 1kuy on RCSB PDB site
Description: X-ray Crystallographic Studies of Serotonin N-acetyltransferase Catalysis and Inhibition
Class: transferase
Keywords: Enzyme-Inhibitor Complex, Bisubstrate Analog, Alternate Conformations, TRANSFERASE
Deposited on 2002-01-22, released 2002-03-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.203
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serotonin n-acetyltransferase
    Species: Ovis aries [TaxId:9940]
    Gene: U29663
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1kuya_
  • Heterogens: COT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kuyA (A:)
    mstpsvhclkpsplhlpsgipgspgrqrrhtlpanefrcltpedaagvfeiereafisvs
    gncplnldevqhfltlcpelslgwfvegrlvafiigslwdeerltqeslalhrprghsah
    lhalavhrsfrqqgkgsvllwrylhhvgaqpavrravlmcedalvpfyqrfgfhpagpca
    ivvgsltftemhcslrghaalrrnsdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kuyA (A:)
    htlpanefrcltpedaagvfeiereafisvsgncplnldevqhfltlcpelslgwfvegr
    lvafiigslwdeerltqeslalhrprghsahlhalavhrsfrqqgkgsvllwrylhhvga
    qpavrravlmcedalvpfyqrfgfhpagpcaivvgsltftemhcsl