SCOP 1.63: Domain d1ku8.1: 1ku8 B:,A:

Lineage for d1ku8.1 (1ku8 B:,A:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.77: beta-Prism I [51091] (3 superfamilies)
   consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.77.3: Mannose-binding lectins [51101] (1 family)

5. Family b.77.3.1: Mannose-binding lectins [51102] (4 proteins)

6. Protein Jacalin [51103] (1 species)

7. Species Jackfruit (Artocarpus integrifolia) [51104] (4 PDB entries)

8. Domain d1ku8.1: 1ku8 B:,A: [73003]

Details for d1ku8.1

PDB Entry: 1ku8, 1.75 Å

PDB Description: Crystal structure of Jacalin

SCOP Domain Sequences for d1ku8.1:

Sequence; same for both SEQRES and ATOM records:

>g1ku8.1 b.77.3.1 (B:,A:) Jacalin {Jackfruit (Artocarpus integrifolia)}
neqsgisqtvivgpwgakXgkafddgaftgireinlsynketaigdfqvvydlngspyvg
qnhksfitgftpvkisldfpseyimevsgytgnvsgyvvvrsltfktnkktygpygvtsg
tpfnlpienglivgfkgsigywldyfsmylsl

Timeline for d1ku8.1:

• d1ku8.1 first appeared in SCOP 1.61
  
• d1ku8.1 appears in SCOP 1.65
  
• d1ku8.1 appears in the current release, SCOPe 2.08