![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.77: beta-Prism I [51091] (4 superfamilies) consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) ![]() |
![]() | Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins) |
![]() | Protein Jacalin [51103] (2 species) |
![]() | Species Jackfruit (Artocarpus heterophyllus) [TaxId:3489] [51104] (10 PDB entries) |
![]() | Domain d1ku8.1: 1ku8 B:,A: [73003] |
PDB Entry: 1ku8 (more details), 1.75 Å
SCOPe Domain Sequences for d1ku8.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1ku8.1 b.77.3.1 (B:,A:) Jacalin {Jackfruit (Artocarpus heterophyllus) [TaxId: 3489]} neqsgisqtvivgpwgakXgkafddgaftgireinlsynketaigdfqvvydlngspyvg qnhksfitgftpvkisldfpseyimevsgytgnvsgyvvvrsltfktnkktygpygvtsg tpfnlpienglivgfkgsigywldyfsmylsl
Timeline for d1ku8.1: