SCOP 1.63: Domain d1ktkc2: 1ktk C:96-208

Lineage for d1ktkc2 (1ktk C:96-208)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (10 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins)

6. Protein Streptococcal superantigen Spe-C [54348] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [54349] (3 PDB entries)

8. Domain d1ktkc2: 1ktk C:96-208 [72981]
   Other proteins in same PDB: d1ktka1, d1ktkb1, d1ktkc1, d1ktkd1, d1ktke1, d1ktke2, d1ktkf1, d1ktkf2

Details for d1ktkc2

PDB Entry: 1ktk, 3 Å

PDB Description: Complex of Streptococcal pyrogenic enterotoxin C (SpeC) with a human T cell receptor beta chain (Vbeta2.1)

SCOP Domain Sequences for d1ktkc2:

Sequence; same for both SEQRES and ATOM records:

>d1ktkc2 d.15.6.1 (C:96-208) Streptococcal superantigen Spe-C {Streptococcus pyogenes}
nkvnhkllgnlfisgesqqnlnnkiilekdivtfqeidfkirkylmdnykiydatspyvs
grieigtkdgkheqidlfdspnegtrsdifakykdnriinmknfshfdiylek

Timeline for d1ktkc2:

• d1ktkc2 first appeared in SCOP 1.61
  
• d1ktkc2 appears in SCOP 1.65
  
• d1ktkc2 appears in the current release, SCOPe 2.08