Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (10 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) |
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins) |
Protein Streptococcal superantigen Spe-C [54348] (1 species) |
Species Streptococcus pyogenes [TaxId:1314] [54349] (3 PDB entries) |
Domain d1ktkc2: 1ktk C:96-208 [72981] Other proteins in same PDB: d1ktka1, d1ktkb1, d1ktkc1, d1ktkd1, d1ktke1, d1ktke2, d1ktkf1, d1ktkf2 |
PDB Entry: 1ktk (more details), 3 Å
SCOP Domain Sequences for d1ktkc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ktkc2 d.15.6.1 (C:96-208) Streptococcal superantigen Spe-C {Streptococcus pyogenes} nkvnhkllgnlfisgesqqnlnnkiilekdivtfqeidfkirkylmdnykiydatspyvs grieigtkdgkheqidlfdspnegtrsdifakykdnriinmknfshfdiylek
Timeline for d1ktkc2: