Lineage for d1ktkf2 (1ktk F:124-240)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 221982Protein T-cell antigen receptor [49125] (6 species)
  7. 221992Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (10 PDB entries)
  8. 222002Domain d1ktkf2: 1ktk F:124-240 [72987]
    Other proteins in same PDB: d1ktka1, d1ktka2, d1ktkb1, d1ktkb2, d1ktkc1, d1ktkc2, d1ktkd1, d1ktkd2, d1ktke1, d1ktkf1
    mutant

Details for d1ktkf2

PDB Entry: 1ktk (more details), 3 Å

PDB Description: Complex of Streptococcal pyrogenic enterotoxin C (SpeC) with a human T cell receptor beta chain (Vbeta2.1)

SCOP Domain Sequences for d1ktkf2:

Sequence, based on SEQRES records: (download)

>d1ktkf2 b.1.1.2 (F:124-240) T-cell antigen receptor {Human (Homo sapiens), beta-chain}
ppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqplkeqp
alndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsae

Sequence, based on observed residues (ATOM records): (download)

>d1ktkf2 b.1.1.2 (F:124-240) T-cell antigen receptor {Human (Homo sapiens), beta-chain}
ppevavfepvclatgfndsryalssrlqnprnhfrvqfyvtqivsae

SCOP Domain Coordinates for d1ktkf2:

Click to download the PDB-style file with coordinates for d1ktkf2.
(The format of our PDB-style files is described here.)

Timeline for d1ktkf2: