Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
Species Mouse (Mus musculus), I-EK [TaxId:10090] [88814] (9 PDB entries) |
Domain d1kt2a2: 1kt2 A:1-81 [72952] Other proteins in same PDB: d1kt2a1, d1kt2b1, d1kt2b2, d1kt2c1, d1kt2d1, d1kt2d2 complexed with nag fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1kt2 (more details), 2.8 Å
SCOPe Domain Sequences for d1kt2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kt2a2 d.19.1.1 (A:1-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-EK [TaxId: 10090]} ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal aniavdkanldvmkersnntp
Timeline for d1kt2a2: