Lineage for d1kt2d1 (1kt2 D:121-215)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2747484Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 2747586Species Mouse (Mus musculus), I-E group [TaxId:10090] [88629] (11 PDB entries)
    probably orthologous to the human HLA-DR group
  8. 2747606Domain d1kt2d1: 1kt2 D:121-215 [72957]
    Other proteins in same PDB: d1kt2a1, d1kt2a2, d1kt2b2, d1kt2c1, d1kt2c2, d1kt2d2
    contains covalently bound peptides at the N-termini of chains B and D
    complexed with nag

Details for d1kt2d1

PDB Entry: 1kt2 (more details), 2.8 Å

PDB Description: crystal structure of class ii mhc molecule iek bound to moth cytochrome c peptide
PDB Compounds: (D:) Fusion protein consisting of cytochrome C peptide, glycine rich linker, and MHC E-beta-k

SCOPe Domain Sequences for d1kt2d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kt2d1 b.1.1.2 (D:121-215) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]}
rveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdw
tfqtlvmletvpqsgevytcqvehpsltdpvtvew

SCOPe Domain Coordinates for d1kt2d1:

Click to download the PDB-style file with coordinates for d1kt2d1.
(The format of our PDB-style files is described here.)

Timeline for d1kt2d1: