SCOPe 2.08: Domain d1kt2b2: 1kt2 B:2-120

Lineage for d1kt2b2 (1kt2 B:2-120)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)

7. Species Mouse (Mus musculus), I-EK [TaxId:10090] [88827] (10 PDB entries)

8. Domain d1kt2b2: 1kt2 B:2-120 [72954]
   Other proteins in same PDB: d1kt2a1, d1kt2a2, d1kt2b1, d1kt2c1, d1kt2c2, d1kt2d1
   contains covalently bound peptides at the N-termini of chains B and D
   complexed with nag
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1kt2b2

PDB Entry: 1kt2, 2.8 Å

PDB Description: crystal structure of class ii mhc molecule iek bound to moth cytochrome c peptide

PDB Compounds: (B:) Fusion protein consisting of cytochrome C peptide, glycine rich linker, and MHC E-beta-k

SCOPe Domain Sequences for d1kt2b2:

Sequence; same for both SEQRES and ATOM records:

>d1kt2b2 d.19.1.1 (B:2-120) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-EK [TaxId: 10090]}
adliaylkqatkggggslvprgsggggsrpwfleycksechfyngtqrvrllvryfynle
enlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvpr

Timeline for d1kt2b2:

• d1kt2b2 first appeared in SCOP 1.61
  
• d1kt2b2 appears in SCOPe 2.07