SCOPe 2.08: Domain d1kp5a1: 1kp5 A:11-245

Lineage for d1kp5a1 (1kp5 A:11-245)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein Green fluorescent protein, GFP [54513] (6 species)

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (285 PDB entries)
   Uniprot P42212

8. Domain d1kp5a1: 1kp5 A:11-245 [72842]
   Other proteins in same PDB: d1kp5a2, d1kp5b2
   cyclic variant with linked natural termini
   complexed with so4

Details for d1kp5a1

PDB Entry: 1kp5, 2.6 Å

PDB Description: cyclic green fluorescent protein

PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d1kp5a1:

Sequence; same for both SEQRES and ATOM records:

>d1kp5a1 d.22.1.1 (A:11-245) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
srkgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptl
vttfsygvqcfsrypdhmkrhdffksampegyvqertisfkddgnyktraevkfegdtlv
nrielkgidfkedgnilghkleynynshnvyitadkqkngikanfkirhniedgsvqlad
hyqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaaglvprgtg

Timeline for d1kp5a1:

• d1kp5a1 first appeared in SCOP 1.61, called d1kp5a_
  
• d1kp5a1 appears in SCOPe 2.07