Lineage for d1kkha1 (1kkh A:1-180)
- Root: SCOP 1.63
Class d: Alpha and beta proteins (a+b) [53931] (224 folds) 
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossoverSuperfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (5 families) 
Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (4 proteins) 
Protein Mevalonate kinase [75353] (2 species) Species Archaeon Methanococcus jannaschii [TaxId:2190] [75354] (1 PDB entry) 
Domain d1kkha1: 1kkh A:1-180 [72645]
Other proteins in same PDB: d1kkha2
complexed with dio
Details for d1kkha1
PDB Entry: 1kkh (more details), 2.4 Å
PDB Description: Crystal Structure of the Methanococcus jannaschii Mevalonate Kinase
SCOP Domain Sequences for d1kkha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kkha1 d.14.1.5 (A:1-180) Mevalonate kinase {Archaeon Methanococcus jannaschii}
prgshmiietpskvilfgehavvygyraismaidltstieiketqedeiilnlndlnksl
glnlneikninpnnfgdfkyclcaikntldylniepktgfkinisskipiscglgssasi
tigtikavsgfynkelkddeiaklgymvekeiqgkasitdtstitykgileiknnkfrki
SCOP Domain Coordinates for d1kkha1:
Click to download the PDB-style file with coordinates for d1kkha1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kkha1:
- d1kkha1 first appeared in SCOP 1.61
- d1kkha1 appears in SCOP 1.65
- d1kkha1 appears in the current release, SCOPe 2.08
View in 3D
